Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain (d.50.2.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: dsRBD-like
Superfamily: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain
Family: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain



Orphan Member
 
Domain: d2ypna2 of protein: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain from Species: Escherichia coli [TaxId: 562]




>1gtka2(d.50.2.1)
NHHETALRVTAERAMNTRLEGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEELLNNGAREILAEVYNGDAPA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)