YcfA-like (d.50.3.2)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: dsRBD-like
Superfamily: YcfA/nrd intein domain
Family: YcfA-like



Orphan Member
 
Domain: d1whza_ of protein: Hypothetical protein TTHA1913 from Species: Thermus thermophilus [TaxId: 274]




>1whza_(d.50.3.2)
MWMPPRPEEVARKLRRLGFVERMAKGGHRLYTHPDGRIVVVPFHSGELPKGTFKRILRDAGLTEEEFHNL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)