Peptidyl-tRNA hydrolase domain (d.50.4.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: dsRBD-like
Superfamily: Peptidyl-tRNA hydrolase domain-like
Family: Peptidyl-tRNA hydrolase domain



Orphan Member
 
Domain: d1j26a_ of protein: Ict1 protein from Species: Mouse (Mus musculus) [TaxId: 10090]




>1j26a_(d.50.4.1)
GSSGSSGEHAKQASSYIPLDRLSISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIEEPVRQKIALTHKNKINKAGELVLTSESSRYQFRNLAECLQKIRDMIAEASGPSSG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)