Rv2632c-like (d.50.5.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: dsRBD-like
Superfamily: Rv2632c-like
Family: Rv2632c-like



Orphan Member
 
Domain: d2fgga1 of protein: Hypothetical protein Rv2632c/MT2708 from Species: Mycobacterium tuberculosis [TaxId: 1773]




>2fgga1(d.50.5.1)
SEHVGKTCQIDVLIEEHDERTRAKARLSWAGRQMVGVGLARLDPADEPVAQIGDELAIARALSDLANQLFALTSSDIEASTHQP

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)