Molybdenum cofactor biosynthesis protein C, MoaC (d.58.21.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Ferredoxin-like
Superfamily: Molybdenum cofactor biosynthesis protein C, MoaC
Family: Molybdenum cofactor biosynthesis protein C, MoaC



Orphan Member
 
Domain: d1eksa_ of protein: Molybdenum cofactor biosynthesis protein C, MoaC from Species: Escherichia coli [TaxId: 562]




>1ekra_(d.58.21.1)
GEAHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSSGDFK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)