Translational regulator protein regA (d.58.27.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Ferredoxin-like
Superfamily: Translational regulator protein regA
Family: Translational regulator protein regA



Orphan Member
 
Domain: d1regy_ of protein: Translational regulator protein regA from Species: Bacteriophage T4 [TaxId: 10665]




>1regy_(d.58.27.1)
MIEITLKKPEDFLKVKETLTRMGIANNKDKVLYQSCHILQKKGLYYIVHFKEMLRMDGRQVEMTEEDEVRRDSIAWLLEDWGLIEIVPGQRTFMKDLTNNFRVISFKQKHEWKLVPKYTI

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)