D-lactate dehydrogenase (d.58.32.2)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Ferredoxin-like
Superfamily: FAD-linked oxidases, C-terminal domain
Family: D-lactate dehydrogenase



Orphan Member
 
Domain: d1f0xb1 of protein: D-lactate dehydrogenase from Species: Escherichia coli [TaxId: 562]




>1f0xb1(d.58.32.2)
KNQQVFYIGTNQPEVLTEIRRHILANFENLPVAGEYMHRDIYDIAELPPRMKNWRDKYEHHLLLKMAGDGVGEAKSWLVDYFKQAEGDFFVCTPEEGSKAFLHRFAAAGAAIRYQAVHSDEVEDILALDIALRRNDTEWYEHLPPEIDSQLVHKLYYGHFMCYVFHQDYIVKKGVDVHALKEQMLELLQQRGAQYPAEHNVGHLYKAPETLQKFYRENDPTNSMNPGIGKTSKRKNW

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)