Actinorhodin biosynthesis monooxygenase ActVa-Orf6 (d.58.4.3)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Ferredoxin-like
Superfamily: Dimeric alpha+beta barrel
Family: Actinorhodin biosynthesis monooxygenase ActVa-Orf6



Orphan Member
 
Domain: d1n5vb_ of protein: Actinorhodin biosynthesis monooxygenase ActVa-Orf6 from Species: Streptomyces coelicolor [TaxId: 1902]




>1lq9b_(d.58.4.3)
AEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIREVPGFLSATYHASTDGTAVVNYAQWESEQAYRVNFGADPRSAELREALSSLPGLMGPPKAVFMTPRGAILPS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)