eEF1-gamma domain (d.58.46.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Ferredoxin-like
Superfamily: eEF1-gamma domain
Family: eEF1-gamma domain



Orphan Member
 
Domain: d1pbua_ of protein: Elongation factor 1-gamma C-terminal domain from Species: Human (Homo sapiens) [TaxId: 9606]




>1pbua_(d.58.46.1)
AKDPFAHLPKSTFALDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)