Hypothetical protein TT1725 (d.58.50.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Ferredoxin-like
Superfamily: Hypothetical protein TT1725
Family: Hypothetical protein TT1725



Orphan Member
 
Domain: d1j27a_ of protein: Hypothetical protein TT1725 from Species: Thermus thermophilus [TaxId: 274]




>1j27a_(d.58.50.1)
MKAYLGLYTARLETPARSLKEKRALIKPALERLKARFPVSAARLYGLDAWGYEVVGFTLLGNDPAWVEETMRAAARFLAEAGGFQVALEEFRLEAFEL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)