Splicing factor U2AF subunits (d.58.7.3)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Ferredoxin-like
Superfamily: RNA-binding domain, RBD
Family: Splicing factor U2AF subunits



Orphan Member
 
Domain: d1jmta_ of protein: U2AF35 (35 KDa subunit) from Species: Human (Homo sapiens) [TaxId: 9606]




>1jmta_(d.58.7.3)
SQTIALLNIYRNPQDGLRSAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQPIHAELSP

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)