Rob transcription factor, C-terminal domain (d.60.1.2)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Probable bacterial effector-binding domain
Superfamily: Probable bacterial effector-binding domain
Family: Rob transcription factor, C-terminal domain



Orphan Member
 
Domain: d1d5yd3 of protein: Rob transcription factor, C-terminal domain from Species: Escherichia coli [TaxId: 562]




>1d5yd3(d.60.1.2)
EFTMPEHKFVTLEDTPLIGVTQSYSCSLEQISDFRHEMRYQFWHDFLGNAPTIPPVLYGLNETRPSQDKDDEQEVFYTTALAQDQADGYVLTGHPVMLQGGEYVMFTYEGLGTGVQEFILTVYGTCMPMLNLTRRKGQDIERYYPAEDDRPINLRCELLIPIRRKLAAA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)