Gyrase inhibitory protein GyrI (SbmC, YeeB) (d.60.1.3)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Probable bacterial effector-binding domain
Superfamily: Probable bacterial effector-binding domain
Family: Gyrase inhibitory protein GyrI (SbmC, YeeB)



Orphan Member
 
Domain: d1jyha_ of protein: Gyrase inhibitory protein GyrI (SbmC, YeeB) from Species: Escherichia coli [TaxId: 562]




>1jyha_(d.60.1.3)
MNYEIKQEEKRTVAGFHLVGPWEQTVKKGFEQLMMWVDSKNIVPKEWVAVYYDNPDETPAEKLRCDTVVTVPGYFTLPENSEGVILTEITGGQYAVAVARVVGDDFAKPWYQFFNSLLQDSAYEMLPKPCFEVYLNNGAEDGYWDIEMYVAVQPK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)