Hypothetical protein At2g34160 (d.68.6.2)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: IF3-like
Superfamily: AlbA-like
Family: Hypothetical protein At2g34160



Orphan Member
 
Domain: d2q3vb_ of protein: automated matches from Species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]




>2q3vb1(d.68.6.2)
KNRIQVSNTKKPLFFYVNLAKRYMQQYNDVELSALGMAIATVVTVTEILKNNGFAVEKKIMTSIVDIKDDARGRPVQKAKIEITLVKSEKFDELMAAA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)