Cyanase C-terminal domain (d.72.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Cyanase C-terminal domain
Superfamily: Cyanase C-terminal domain
Family: Cyanase C-terminal domain



Orphan Member
 
Domain: d2ivqj2 of protein: automated matches from Species: Escherichia coli [TaxId: 562]




>1dwkj2(d.72.1.1)
RIPTDPTMYRFYEMLQVYGTTLKALVHEKFGDGIISAINFKLDVKKVADPEGGERAVITLDGKYLPTKPF

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)