PH0730 C-terminal domain-like (d.74.4.2)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: DCoH-like
Superfamily: GAD domain-like
Family: PH0730 C-terminal domain-like



Orphan Member
 
Domain: d2p8ta2 of protein: Hypothetical protein PH0730 from Species: Pyrococcus horikoshii [TaxId: 53953]




>d2p8ta2|d.74.4.2
MFSEPIGVSVDGYPGIAIVVKNPPEFKSIELRDEAIKFDAKGAMILTVKDNEIVFPEDFR
PLKEMYPEVAKKIVDYEDGDAVIITWAETPAKALKSAIHVAYILKKEEITPEILEVV

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)