Hypothetical protein HI1388.1 (d.80.1.4)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Tautomerase/MIF
Superfamily: Tautomerase/MIF
Family: Hypothetical protein HI1388.1



Orphan Member
 
Domain: d1mwwc_ of protein: Hypothetical protein HI1388.1 from Species: Haemophilus influenzae [TaxId: 727]




>1mwwb_(d.80.1.4)
MITVFGLKSKLAPRREKLAEVIYNSLHLGLDIPKGKHAIRFLCLEKEDFYYPFDRSDDYTVIEINLMAGRMEGTKKRLIKMLFSELEYKLGIRAHDVEITIKEQPAHCWGFRGMTGDE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)