Biliverdin reductase (d.81.1.4)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: FwdE/GAPDH domain-like
Superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
Family: Biliverdin reductase



Orphan Member
 
Domain: d1lc3a2 of protein: Biliverdin reductase from Species: Norway rat (Rattus norvegicus) [TaxId: 10116]




>1lc0a2(d.81.1.4)
MEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGVN

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)