Activator of Hsp90 ATPase, Aha1 (d.83.2.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Aha1/BPI domain-like
Superfamily: Activator of Hsp90 ATPase, Aha1
Family: Activator of Hsp90 ATPase, Aha1



Orphan Member
 
Domain: d1usvh_ of protein: Activator of Hsp90 ATPase, Aha1 from Species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]




>1usub_(d.83.2.1)
VDKNCIGWAKEYFKQKIVGVEAKKYAKIKSVSSIEGDCEVNQRGKVISLFDLKITVLIEGHVDSALPFEGSINVPEVAFDSEASSYQFDISIFKETSELSEAKPLIRSELLPKLRQIFQQFGKDLLATHGND

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)