DNA-binding domain of REP protein (d.89.1.4)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Origin of replication-binding domain, RBD-like
Superfamily: Origin of replication-binding domain, RBD-like
Family: DNA-binding domain of REP protein



Orphan Member
 
Domain: d1l5ia_ of protein: DNA-binding domain of REP protein from Species: Geminivirus (Tomato yellow leaf curl virus - sardinia) [TaxId: 123735]




>1l5ia_(d.89.1.4)
SGRFSIKAKNYFLTYPKCDLTKENALSQITNLQTPTNKLFIKICRELHENGEPHLHILIQFEGKYNCTNQRFFDLVSPTRSAHFHPNIQGAKSSSDVKSYIDKDGDVLEWGTFQIDGR

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)