Caur0242-like (d.92.1.16)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Zincin-like
Superfamily: Metalloproteases ("zincins"), catalytic domain
Family: Caur0242-like



Orphan Member
 
Domain: d3cmna1 of protein: Uncharacterized protein Caur0242 from Species: Chloroflexus aurantiacus [TaxId: 1108]




>d3cmna1|d.92.1.16
LIDWEQARQAALRLSQWEQAPVDNRAFRREQYARMVALSEPLIADYLGVRLPEPVSRIFV
FDRREWLEANIVSFSQLFRPIEEMYEKSSKLLGVQIGGLLGYLAQRVLGQYDLSLLSAGG
SLYFVEPNIARVQQQLGLSDEDFRLWITLHEMTHAFEFEAYPWVRTYFRELLEQNFALTP
EQRAVFDRIQALMSLIEGYGNHVMNAVGRRLLPSFNQIEQQIAQRQRQRTMLDQMVFRLT
GLDLKLAQYQQGEAFVNAVVAARGIQFASRVWERPENLPSMDEIRNPGQWIVRM

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)