Glucose permease domain IIB (d.95.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Homing endonuclease-like
Superfamily: Glucose permease domain IIB
Family: Glucose permease domain IIB



Orphan Member
 
Domain: d3bp8d_ of protein: Glucose permease domain IIB from Species: Escherichia coli [TaxId: 562]




>1o2fb_(d.95.1.1)
EMAAALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRN

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)