DNA primase DnaG catalytic core (e.13.1.1)


SCOP classification
 
Class: Multi-domain proteins (alpha and beta)
Fold: DNA primase core
Superfamily: DNA primase core
Family: DNA primase DnaG catalytic core



Orphan Member
 
Domain: d3b39b_ of protein: automated matches from Species: Escherichia coli K-12 [TaxId: 83333]




>1dd9a_(e.13.1.1)
TLYQLMDGLNTFYQQSLQQPVATSARQYLEKRGLSHEVIARFAIGFAPPGWDNVLKRFGGNPENRQSLIDAGMLVTNRSYDRFRERVMFPIRDKRGRVIGFGGRVLGNDTPKYLNSPETDIFHKGRQLYGLYEAQQDNAEPNRLLVVEGYMDVVALAQYGINYAVASLGSTTADHIQLLFRATNNVICCYDGDRAGRDAAWRALETALPYMTDGRQLRFMFLPDGEDPDTLVRKEGKEAFEARMEQAMPLSAFLFNSLMPQVDLSTPDGRARLSTLALPLISQVPGETLRIYLRQELGNKLGILDDSQLE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)