Replication terminator protein (Tus) (e.2.1.1)


SCOP classification
 
Class: Multi-domain proteins (alpha and beta)
Fold: Replication terminator protein (Tus)
Superfamily: Replication terminator protein (Tus)
Family: Replication terminator protein (Tus)



Orphan Member
 
Domain: d2i06a_ of protein: Replication terminator protein (Tus) from Species: Escherichia coli [TaxId: 562]




>2ewja1(e.2.1.1)
DLVDRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLHDPATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQKQVQHACPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLHLYVAD

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)