39 kda initiator binding protein, IBP39, C-terminal domains (e.47.1.1)


SCOP classification
 
Class: Multi-domain proteins (alpha and beta)
Fold: 39 kda initiator binding protein, IBP39, C-terminal domains
Superfamily: 39 kda initiator binding protein, IBP39, C-terminal domains
Family: 39 kda initiator binding protein, IBP39, C-terminal domains



Orphan Member
 
Domain: d1q89a_ of protein: 39 kda initiator binding protein, IBP39, C-terminal domains from Species: Trichomonas vaginalis [TaxId: 5722]




>1q87b_(e.47.1.1)
SMCIGNSTPNEQETFRAKVDEIWFRLTQKTDGTVMRDFLIEKAAEYFKQPEQPKQNAIEVISAIMAPQEEQTKSKADLYKFLAMFGPYETIMLKIASLLLISNNKGHWLTFDPQAEKNASISGWFDQNEPNCLILKTPTGIRKIWNKPLIEATGQYLMDENGEKYDSWDKYFEMKPIETYLTAYPTFAPMHHH

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)