FdhE-like (e.59.1.1)


SCOP classification
 
Class: Multi-domain proteins (alpha and beta)
Fold: FdhE-like
Superfamily: FdhE-like
Family: FdhE-like



Orphan Member
 
Domain: d2fiyb_ of protein: FdhE homolog PA4809 from Species: Pseudomonas aeruginosa [TaxId: 287]




>2fiya1(e.59.1.1)
PHLHQPSRDLFARRGERLLQLAEGHPMGDYLRLVAGLCRLQQALLDNPPALAPLDPERLRKSREHGMPPLAYDLLVREGAWLPWLDALLAGYPAPANAAVGAALEQLREAEEGQRKAWAIALLSGQFDLLPAALVPFLGAALQVAWSHWLLGLEEGAVVETESRTLCPACGSPPMAGMIRQTGLRYLSCSLCACEWHYVRIKCSHCEESKHLAYLSLEHGQPAEKAVLRAETCPSCQGYLKQFYLEFDRHADALADDLASLALDMRLAEDGYLRRSPNLLLAPGG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)