E2F dimerization segment (e.63.1.2)


SCOP classification
 
Class: Multi-domain proteins (alpha and beta)
Fold: E2F-DP heterodimerization region
Superfamily: E2F-DP heterodimerization region
Family: E2F dimerization segment



Orphan Member
 
Domain: d2azeb1 of protein: Transcription factor E2F1 from Species: Human (Homo sapiens) [TaxId: 9606]




>2azeb1(e.63.1.2)
GRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPEE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)