Api92-like (e.66.1.1)


SCOP classification
 
Class: Multi-domain proteins (alpha and beta)
Fold: Api92-like
Superfamily: Api92-like
Family: Api92-like



Orphan Member
 
Domain: d2ijra1 of protein: Hypothetical protein api92 from Species: Yersinia pseudotuberculosis [TaxId: 633]




>d2ijra1|e.66.1.1
EWCKNRLEITGRSVFVDIQQWVTGEEVPLYRHAIQQSIRLFLAGCAGILKPVKCEYPPFP
RLVSHGTGSAVASNLAFQHWLDLLLKDAVLDGDTIRQIDRIYLQSGIASVKWETIPEGAR
QIITQLARQYPDWFGVASWSSHINGADCWTKLGVQEHACNCDLIIPTRLAIELNGNSQLL
TGVSTTHDLYSHLYGAWPSGQNIIWQRDRINSLRLDFDSPSYPPSAELGELSAVFDCEIR
HWYQEPVNGIRGYDCYDRGDHVDSGEYGAGPF

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)