Pan module (APPLE domain) (g.10.1.3)


SCOP classification
 
Class: Small proteins
Fold: Hairpin loop containing domain-like
Superfamily: Hairpin loop containing domain-like
Family: Pan module (APPLE domain)



Orphan Member
 
Domain: d1hkya_ of protein: Pan module from microneme protein 5 (MIC-5) from Species: Eimeria tenella [TaxId: 5802]




>1hkya_(g.10.1.3)
DYKDDDDKVKLTCYQNGVSFTGGKAISEAKAASSQACQELCEKDAKCRFFTLASGKCSLFADDAALRPTKSDGAVSGNKRCILLED

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)