Variant surface glycoprotein MITAT 1.2, VSG 221, C-terminal domain (g.16.3.1)


SCOP classification
 
Class: Small proteins
Fold: Trefoil/Plexin domain-like
Superfamily: Variant surface glycoprotein MITAT 1.2, VSG 221, C-terminal domain
Family: Variant surface glycoprotein MITAT 1.2, VSG 221, C-terminal domain



Orphan Member
 
Domain: d1xu6a_ of protein: Variant surface glycoprotein MITAT 1.2, VSG 221, C-terminal domain from Species: Trypanosoma brucei brucei [TaxId: 5702]




>1xu6a_(g.16.3.1)
GSHMLEVLTQKHKPAESQQQAAETEGSCNKKDQNECKSPCKWHNDAENKKCTLDKEEAKKVADETAKDGKTGNTNTTGSS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)