Coagulogen (g.17.1.5)


SCOP classification
 
Class: Small proteins
Fold: Cystine-knot cytokines
Superfamily: Cystine-knot cytokines
Family: Coagulogen



Orphan Member
 
Domain: d1aocb_ of protein: Coagulogen from Species: Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]




>1aocb_(g.17.1.5)
ADTNAPICLCDEPGVLGRTQIVTTEIKDKIEKAVEAVAQESGVSGRGFSIFSHHPVFRECGKYECRTVRPEHSRCYNFPPFTHFKSECPVSTRDCEPVFGYTVAGEFRVIVQAPRAGFRQCVWQHKCRFGSNSCGYNGRCTQQRSVVRLVTYNLEKDGFLCESFRTCCGCPCRSF

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)