Noggin (g.17.1.7)


SCOP classification
 
Class: Small proteins
Fold: Cystine-knot cytokines
Superfamily: Cystine-knot cytokines
Family: Noggin



Orphan Member
 
Domain: d1m4ua_ of protein: Noggin from Species: Human (Homo sapiens) [TaxId: 9606]




>1m4ua_(g.17.1.7)
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)