Crisp domain (g.19.1.2)


SCOP classification
 
Class: Small proteins
Fold: Crisp domain-like
Superfamily: Crisp domain-like
Family: Crisp domain



Orphan Member
 
Domain: d1rc9a2 of protein: Cysteine-rich secretory protein (SteCRISP) from Species: Chinese green tree viper (Trimeresurus stejnegeri) [TaxId: 39682]




>1rc9a2(g.19.1.2)
TPCGDCPSDCDNGLCTNPCTRENKFTNCNTMVQQSSCQDNYMKTNCPASCFCQNKII

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)