BSTI (g.22.1.2)


SCOP classification
 
Class: Small proteins
Fold: Serine protease inhibitors
Superfamily: Serine protease inhibitors
Family: BSTI



Orphan Member
 
Domain: d1hx2a_ of protein: BSTI from Species: Fire-bellied toad (Bombina bombina) [TaxId: 8345]




>1hx2a_(g.22.1.2)
NFVCPPGQTFQTCASSCPKTCETRNKLVLCDKKCNQRCGCISGTVLKSKDSSECVHPSKC

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)