Cripto EGF-like domain-like (g.3.11.7)


SCOP classification
 
Class: Small proteins
Fold: Knottins (small inhibitors, toxins, lectins)
Superfamily: EGF/Laminin
Family: Cripto EGF-like domain-like



Orphan Member
 
Domain: d2j5ha1 of protein: Cripto growth factor from Species: Mouse (Mus musculus) [TaxId: 10090]




>2j5ha1(g.3.11.7)
KEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCD

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)