Palicourein (g.3.3.4)


SCOP classification
 
Class: Small proteins
Fold: Knottins (small inhibitors, toxins, lectins)
Superfamily: Cyclotides
Family: Palicourein



Orphan Member
 
Domain: d1r1fa_ of protein: Palicourein from Species: Palicourea condensata [TaxId: 272141]




>1r1fa_(g.3.3.4)
TFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRNGDP

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)