Gurmarin, a sweet taste-suppressing polypeptide (g.3.4.1)


SCOP classification
 
Class: Small proteins
Fold: Knottins (small inhibitors, toxins, lectins)
Superfamily: Gurmarin-like
Family: Gurmarin, a sweet taste-suppressing polypeptide



Orphan Member
 
Domain: d1gura_ of protein: Gurmarin, a sweet taste-suppressing polypeptide from Species: Gymnema sylvestre [TaxId: 4068]




>1gura_(g.3.4.1)
EQCVKKDELCIPYYLDCCEPLECKKVNWWDHKCIG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)