Defensin MGD-1 (g.3.7.3)


SCOP classification
 
Class: Small proteins
Fold: Knottins (small inhibitors, toxins, lectins)
Superfamily: Scorpion toxin-like
Family: Defensin MGD-1



Orphan Member
 
Domain: d1fjna_ of protein: Defensin MGD-1 from Species: Mediterranean mussel (Mytilus galloprovincialis) [TaxId: 29158]




>1fjna_(g.3.7.3)
GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRCG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)