variant C2H2 finger (g.37.1.5)


SCOP classification
 
Class: Small proteins
Fold: beta-beta-alpha zinc fingers
Superfamily: beta-beta-alpha zinc fingers
Family: variant C2H2 finger



Orphan Member
 
Domain: d1wira_ of protein: Protein arginine N-methyltransferase 3 from Species: Mouse (Mus musculus) [TaxId: 10090]




>1wira_(g.37.1.5)
GSSGSSGEPAHGRQHTPCLFCDRLFASAEETFSHCKLEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKDEYLKPVLEDDLLLQFDVEDLYEPVSTPFSSGPSSG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)