NOB1 zinc finger-like (g.41.15.1)


SCOP classification
 
Class: Small proteins
Fold: Rubredoxin-like
Superfamily: NOB1 zinc finger-like
Family: NOB1 zinc finger-like



Orphan Member
 
Domain: d2cona1 of protein: RNA-binding protein NOB1 (Nin one binding) from Species: Mouse (Mus musculus) [TaxId: 10090]




>2cona1(g.41.15.1)
VREARSYILRCHGCFKTTSDMNRVFCGHCGNKTLKKVSVTINDDGTLHMHFSRNPKVLNPRGLRYS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)