PhnA zinc-binding domain (g.41.3.5)


SCOP classification
 
Class: Small proteins
Fold: Rubredoxin-like
Superfamily: Zinc beta-ribbon
Family: PhnA zinc-binding domain



Orphan Member
 
Domain: d2akla2 of protein: Hypothetical protein PA0128, N-terminal domain from Species: Pseudomonas aeruginosa [TaxId: 287]




>2akla2(g.41.3.5)
STLPPCPQCNSEYTYEDGALLVCPECAHEWSPNEAATA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)