Hypothetical protein MTH1184 (g.41.6.1)


SCOP classification
 
Class: Small proteins
Fold: Rubredoxin-like
Superfamily: Hypothetical protein MTH1184
Family: Hypothetical protein MTH1184



Orphan Member
 
Domain: d1gh9a_ of protein: Hypothetical protein MTH1184 from Species: Methanobacterium thermoautotrophicum [TaxId: 145262]




>1gh9a_(g.41.6.1)
MYIIFRCDCGRALYSREGAKTRKCVCGRTVNVKDRRIFGRADDFEEASELVRKLQEEKYGSCHFTNPSKRE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)