Pyk2-associated protein beta ARF-GAP domain (g.45.1.1)


SCOP classification
 
Class: Small proteins
Fold: ArfGap/RecO-like zinc finger
Superfamily: ArfGap/RecO-like zinc finger
Family: Pyk2-associated protein beta ARF-GAP domain



Orphan Member
 
Domain: d1dcqa2 of protein: Pyk2-associated protein beta ARF-GAP domain from Species: Mouse (Mus musculus) [TaxId: 10090]




>1dcqa2(g.45.1.1)
LTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLGTSELLLAKNIGNAGFNEIMECCLPSEDPVKPNPGSDMIARKDYITAKYMERRYARKKH

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)