Midkine, a heparin-binding growth factor, N-terminal domain (g.5.1.1)


SCOP classification
 
Class: Small proteins
Fold: Midkine
Superfamily: Midkine
Family: Midkine, a heparin-binding growth factor, N-terminal domain



Orphan Member
 
Domain: d1mkna_ of protein: Midkine, a heparin-binding growth factor, N-terminal domain from Species: Synthetic




>1mkna_(g.5.1.1)
KKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)