variant PHD-like domain (g.50.1.3)


SCOP classification
 
Class: Small proteins
Fold: FYVE/PHD zinc finger
Superfamily: FYVE/PHD zinc finger
Family: variant PHD-like domain



Orphan Member
 
Domain: d1wila_ of protein: Hypothetical protein KIAA1045 from Species: Human (Homo sapiens) [TaxId: 9606]




>1wila_(g.50.1.3)
GSSGSSGPREPVVNDEMCDVCEVWTAESLFPCRVCTRVFHDGCLRRMGYIQGDSAAEVTEMAHTETGWSCHYCDNINLLLTEESGPSSG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)