Necrosis inducing protein 1, NIP1 (g.70.1.1)


SCOP classification
 
Class: Small proteins
Fold: Necrosis inducing protein 1, NIP1
Superfamily: Necrosis inducing protein 1, NIP1
Family: Necrosis inducing protein 1, NIP1



Orphan Member
 
Domain: d1kg1a_ of protein: Necrosis inducing protein 1, NIP1 from Species: Leaf blotch of barley (Rhynchosporium secalis) [TaxId: 38038]




>1kg1a_(g.70.1.1)
DRCRYTLCCDGALKAVSACLHESESCLVPGDCCRGKSRLTLCSYGEGGNGFQCPTGYRQC

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)