CCHHC domain (g.73.1.1)


SCOP classification
 
Class: Small proteins
Fold: CCHHC domain
Superfamily: CCHHC domain
Family: CCHHC domain



Orphan Member
 
Domain: d1pxea_ of protein: Neural zinc finger transcription factor 1 from Species: Norway rat (Rattus norvegicus) [TaxId: 10116]




>1pxea_(g.73.1.1)
RESKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRVPPEILAMHENVLK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)