WRKY DNA-binding domain (g.79.1.1)


SCOP classification
 
Class: Small proteins
Fold: WRKY DNA-binding domain
Superfamily: WRKY DNA-binding domain
Family: WRKY DNA-binding domain



Orphan Member
 
Domain: d2lexa_ of protein: WRKY DNA-binding protein 4 from Species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]




>1wj2a_(g.79.1.1)
VQTTSEVDLLDDGYRWRKYGQKVVKGNPYPRSYYKCTTPGCGVRKHVERAATDPKAVVTTYEGKHNHDLPA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)