HIT zinc finger (g.85.1.2)


SCOP classification
 
Class: Small proteins
Fold: HIT/MYND zinc finger-like
Superfamily: HIT/MYND zinc finger-like
Family: HIT zinc finger



Orphan Member
 
Domain: d1x4sa1 of protein: Zinc finger HIT domain containing protein 2, ZNHIT2 from Species: Human (Homo sapiens) [TaxId: 9606]




>1x4sa1(g.85.1.2)
MEPAGPCGFCPAGEVQPARYTCPRCNAPYCSLRCYRTHGTCAENFY

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)