Coronavirus NSP10-like (g.86.1.1)


SCOP classification
 
Class: Small proteins
Fold: Coronavirus NSP10-like
Superfamily: Coronavirus NSP10-like
Family: Coronavirus NSP10-like



Orphan Member
 
Domain: d3r24b_ of protein: automated matches from Species: SARS coronavirus [TaxId: 227859]




>2fyga1(g.86.1.1)
HHHHNSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGC

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)